missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NARF Polyclonal specifically detects NARF in Human samples. It is validated for Western Blot.
Specifications
Tekniske data
| Antigen | NARF |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | FLJ10067, IOP2DKFZp434G0420, Iron-only hydrogenase-like protein 2, nuclear prelamin A recognition factor, prenyl-dependent prelamin A binding protein |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NARF (NP_001033707). Peptide sequence RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS |
| Purification Method | Affinity purified |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?