NAPRT1 Antibody (CL0366), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-52924

Product Code. 18627666

Description

NAPRT1 Monoclonal antibody specifically detects NAPRT1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NAPRT1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL0366
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: EC 2.4.2.11, FHA-HIT-interacting protein, FHIP, NAPRTase, nicotinate phosphoribosyltransferase, nicotinate phosphoribosyltransferase domain containing 1, Nicotinate phosphoribosyltransferase domain-containing protein 1, nicotinic acid phosphoribosyltransferase, PP3856
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 93100
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1