NAPG, Mouse anti-Human, Clone: 4B5, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00008774-M03.100ug

Product Code. 16149225

Description

Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEK

Specifications

• Antigen: NAPG
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: N-ethylmaleimide-sensitive factor attachment protein, gamma
• Gene Alias: GAMMASNAP
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4B5
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_003826
• Gene Symbols: NAPG
• Immunogen: NAPG (NP_003817.1, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 8774
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ