NAP1L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP1-81162

Artikelnummer. 18229295

Beskrivelse

NAP1L1 Polyclonal specifically detects NAP1L1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Tekniske data

• Antigen: NAP1L1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P55209
• Gene Symbols: NAP1L1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human NAP1L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: hNRP, HSP22-like protein interacting protein, MGC23410, MGC8688, NAP1, NAP-1 related protein, NAP1LFLJ16112, NRPNAP-1-related protein, nucleosome assembly protein 1-like 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 4673
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only