missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nanog Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£251.00 - £437.00
Specifications
| Antigen | Nanog |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666064
|
Novus Biologicals
NBP3-21353-25ul |
25 μg |
£251.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624155
|
Novus Biologicals
NBP3-21353-100ul |
100 μg |
£437.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Nanog Polyclonal antibody specifically detects Nanog in Human samples. It is validated for ImmunofluorescenceSpecifications
| Nanog | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Autophagy, Cancer, Cellular Markers, Macroautophagy, mTOR Pathway, Neurodegeneration, Protein Turnover, Regulatory Immunology, Signal Transduction, Stem Cell Markers, Stem Cell Signaling Pathway, Ubiquitin Proteasome Pathway | |
| PBS, pH 7.2, 40% glycerol | |
| 79923 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ12581, FLJ40451, hNanog, homeobox protein NANOG, Homeobox transcription factor Nanog, homeobox transcription factor Nanog-delta 48, Nanog homeobox | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title