missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NALP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
NALP4 Polyclonal antibody specifically detects NALP4 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | NALP4 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | Cancer/testis antigen 58, CLR19.5, CT58PYRIN and NACHT-containing protein 2, FLJ32126, NACHT, leucine rich repeat and PYD containing 4, NACHT, LRR and PYD domains-containing protein 4, NALP4NACHT, LRR and PYD containing protein 4, NLR family, pyrin domain containing 4, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 4, PAN2Ribonuclease inhibitor 2, PYPAF4PAAD and NACHT-containing protein 2, RNH2PYRIN-containing APAF1-like protein 4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS |
| Purification Method | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?