missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NALP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
NALP4 Polyclonal antibody specifically detects NALP4 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | NALP4 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | Cancer/testis antigen 58, CLR19.5, CT58PYRIN and NACHT-containing protein 2, FLJ32126, NACHT, leucine rich repeat and PYD containing 4, NACHT, LRR and PYD domains-containing protein 4, NALP4NACHT, LRR and PYD containing protein 4, NLR family, pyrin domain containing 4, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 4, PAN2Ribonuclease inhibitor 2, PYPAF4PAAD and NACHT-containing protein 2, RNH2PYRIN-containing APAF1-like protein 4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?