missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAD Synthetase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | NAD Synthetase |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18258752
|
Novus Biologicals
NBP2-58373 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603458
|
Novus Biologicals
NBP2-58373-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NAD Synthetase Polyclonal specifically detects NAD Synthetase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| NAD Synthetase | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55191 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHHVLRKANTRVDLVTMVTSKNGGIY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| EC 6.3.5.1, FLJ10631, FLJ36703, FLJ40627, glutamine-dependent NAD synthetase, glutamine-dependent NAD(+) synthetase, NAD synthetase 1, NAD(+) synthase, NAD(+) synthase [glutamine-hydrolyzing], NAD(+) synthetase | |
| NADSYN1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title