missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAA11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | NAA11 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NAA11 Polyclonal specifically detects NAA11 in Rat samples. It is validated for Western Blot.Specifications
| NAA11 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ARD1 homolog B, ARD1B, ARD2, hARD2, human arrest defective 2, MGC10646, N(alpha)-acetyltransferase 11, NatA catalytic subunit, NatA catalytic subunit, N-terminal acetyltransferase complex ARD1 subunit homolog B | |
| NAA11 | |
| IgG |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| NP_001019913 | |
| 84779 | |
| The specific Immunogen is proprietary information. Peptide sequence SAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title