missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N4BP2L1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94417-0.1ml
This item is not returnable.
View return policy
Description
N4BP2L1 Polyclonal antibody specifically detects N4BP2L1 in Mouse samples. It is validated for Western Blot
Specifications
| N4BP2L1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CG018, CG081, NEDD4 binding protein 2-like 1, NEDD4-binding protein 2-like 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human N4BP2L1 (NP_001073159). FRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTN | |
| 0.1 mL | |
| Cell Biology | |
| 90634 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction