missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94188-0.02ml
This item is not returnable.
View return policy
Description
N-Acetylglucosaminyltransferase V/MGAT5 Polyclonal antibody specifically detects N-Acetylglucosaminyltransferase V/MGAT5 in Human, Mouse samples. It is validated for Western Blot
Specifications
| N-Acetylglucosaminyltransferase V/MGAT5 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A, Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase, EC 2.4.1.155, GGNT5, GlcNAc-T V, GNT-VGNT-VA, Mannoside acetylglucosaminyltransferase 5, mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, N-acetylglucosaminyl-transferase V | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human N-Acetylglucosaminyltransferase V/MGAT5 (NP_002401.1). HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL | |
| 0.02 mL | |
| Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 4249 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction