missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N-Acetylglucosaminyltransferase III/MGAT3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33478-100ul
This item is not returnable.
View return policy
Description
N-Acetylglucosaminyltransferase III/MGAT3 Monoclonal antibody specifically detects N-Acetylglucosaminyltransferase III/MGAT3 in Mouse samples. It is validated for ELISA,Western Blot
Specifications
| N-Acetylglucosaminyltransferase III/MGAT3 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, EC 2.4.1.144, FLJ43371, GGNT3, GlcNAc-T III, GNT3, GNT-IIIMGC142278, mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, MGC141943, N-acetylglucosaminyltransferase III, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III | |
| A synthetic peptide corresponding to a sequence within amino acids 381-480 of human N-Acetylglucosaminyltransferase III/MGAT3 (NP_002400.3).,, Sequence:, LRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEH | |
| 100 μL | |
| Primary | |
| Mouse | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4248 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction