N-Acetylglucosaminyltransferase III/MGAT3 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33478-20ul

Product Code. 30232704

Description

N-Acetylglucosaminyltransferase III/MGAT3 Monoclonal antibody specifically detects N-Acetylglucosaminyltransferase III/MGAT3 in Mouse samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: N-Acetylglucosaminyltransferase III/MGAT3
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, EC 2.4.1.144, FLJ43371, GGNT3, GlcNAc-T III, GNT3, GNT-IIIMGC142278, mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, MGC141943, N-acetylglucosaminyltransferase III, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 381-480 of human N-Acetylglucosaminyltransferase III/MGAT3 (NP_002400.3).,, Sequence:, LRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEH
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4248
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG