missing translation for 'onlineSavingsMsg'
Learn More
Learn More
N-Acetyl-D-Glucosamine Kinase/NAGK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | N-Acetyl-D-Glucosamine Kinase/NAGK |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18650286
|
Novus Biologicals
NBP2-38240-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18158437
|
Novus Biologicals
NBP2-38240 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
N-Acetyl-D-Glucosamine Kinase/NAGK Polyclonal specifically detects N-Acetyl-D-Glucosamine Kinase/NAGK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| N-Acetyl-D-Glucosamine Kinase/NAGK | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.7.1.59, GNKGlcNAc kinase, N-acetyl-D-glucosamine kinase, N-acetylglucosamine kinaseHSA242910 | |
| NAGK | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9UJ70 | |
| 55577 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title