missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myotilin Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £366.00
Specifications
| Antigen | Myotilin |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:10 - 1:100 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666392
|
Novus Biologicals
NBP2-94022-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18666202
|
Novus Biologicals
NBP2-94022-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Myotilin Polyclonal antibody specifically detects Myotilin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Myotilin | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 9499 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:10 - 1:100 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 57 kDa cytoskeletal protein, LGMD1A, limb-girdle muscular dystrophy 1A (autosomal dominant), Myofibrillar titin-like Ig domains protein, myotilin, Titin immunoglobulin domain protein, titin immunoglobulin domain protein (myotilin), TTIDLGMD1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 259-314 of human MYOT (NP_001129412.1). RPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title