missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18366647

Myosin Phosphatase 2 Antibody, Novus Biologicals™

Product Code. 18366647 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18366647 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18366647 Supplier Novus Biologicals Supplier No. H00004660B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

Myosin Phosphatase 2 Polyclonal antibody specifically detects Myosin Phosphatase 2 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Myosin Phosphatase 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH34430
Gene Alias MGC131980, MGC87886, Myosin phosphatase target subunit 2, myosin phosphatase, target subunit 2, Myosin phosphatase-targeting subunit 2, MYPT 2, MYPT2FLJ40942, protein phosphatase 1 regulatory subunit 12B, protein phosphatase 1, regulatory (inhibitor) subunit 12B
Host Species Mouse
Immunogen PPP1R12B (AAH34430, 1 a.a. - 386 a.a.) full-length human protein. MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4660
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.