missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myosin heavy chain 14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49626
This item is not returnable.
View return policy
Description
Myosin heavy chain 14 Polyclonal antibody specifically detects Myosin heavy chain 14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Myosin heavy chain 14 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| DFNA4, DFNA4A, FP17425, MHC16, MYH14, MYH17, myosin, heavy chain 14, non-muscle, NMHC II-C, NMHC-II-C, PNMHH | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE | |
| 0.1 mL | |
| Cell Biology, Cellular Markers, Hypoxia, Stem Cell Markers | |
| 79784 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction