missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myosin heavy chain 13 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £359.00
Specifications
| Antigen | Myosin heavy chain 13 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:100, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18650068
|
Novus Biologicals
NBP3-05614-100ul |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615268
|
Novus Biologicals
NBP3-05614-20ul |
20 μg |
£149.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Myosin heavy chain 13 Polyclonal antibody specifically detects Myosin heavy chain 13 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Myosin heavy chain 13 | |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| MYH13, MYH13 myosin, heavy chain 13, skeletal muscle, MyHC-eo | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human Myosin heavy chain 13 (NP_003793.2). EALSKSKSNIERTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:100, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| 8735 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title