missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18408358

MYLC2PL Antibody, Novus Biologicals™

Product Code. 18408358 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18408358 0.05 mg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18408358 Supplier Novus Biologicals Supplier No. H00093408B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

MYLC2PL Polyclonal antibody specifically detects MYLC2PL in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MYLC2PL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_612412.2
Gene Alias MYLC2PLMGC3479, Myosin light chain 2, lymphocyte-specific, myosin regulatory light chain 10, myosin, light chain 10, regulatory, PLRLCmyosin light chain 2, precursor lymphocyte-specific, Precursor lymphocyte-specific regulatory light chain
Host Species Mouse
Immunogen MYLC2PL (NP_612412.2, 1 a.a. - 226 a.a.) full-length human protein. MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
Purification Method Protein G purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 93408
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.