Myelin Protein Zero Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33312-100ul

Product Code. 30230337

Description

Myelin Protein Zero Monoclonal antibody specifically detects Myelin Protein Zero in Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: Myelin Protein Zero
• Classification: Monoclonal
• Dilution: Western Blot 1:2000 - 1:20000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: Charcot-Marie-Tooth neuropathy 1B, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, HMSNIB, MPP, Myelin peripheral protein, myelin protein P0, myelin protein zeroDSS, P0
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 149-248 of human Myelin Protein Zero (MPZ) (NP_000521.2).,, Sequence:, KVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
• Quantity: 100 μL
• Research Discipline: Neuronal Cell Markers, Oligodendrocyte Cell Markers
• Gene ID (Entrez): 4359
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified