missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myelin Protein Zero Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33312-20ul
This item is not returnable.
View return policy
Description
Myelin Protein Zero Monoclonal antibody specifically detects Myelin Protein Zero in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Myelin Protein Zero | |
| Monoclonal | |
| Western Blot 1:2000 - 1:20000, ELISA Recommended starting concentration is 1 μg/mL | |
| Charcot-Marie-Tooth neuropathy 1B, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, HMSNIB, MPP, Myelin peripheral protein, myelin protein P0, myelin protein zeroDSS, P0 | |
| A synthetic peptide corresponding to a sequence within amino acids 149-248 of human Myelin Protein Zero (MPZ) (NP_000521.2).,, Sequence:, KVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK | |
| 20 μL | |
| Neuronal Cell Markers, Oligodendrocyte Cell Markers | |
| 4359 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction