Myelin PLP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-60071

Product Code. 18244833

Description

Myelin PLP Polyclonal specifically detects Myelin PLP in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Myelin PLP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HLD1, lipophilin, major myelin proteolipid protein, MMPL, myelin proteolipid protein, PLP, PLP/DM20, PMD, proteolipid protein 1, spastic paraplegia 2, uncomplicated, SPG2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
• Gene Accession No.: P60201
• Gene Symbols: PLP1
• Immunogen: Synthetic peptides corresponding to PLP1(proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated)) The peptide sequence was selected from the N terminal of PLP1. Peptide sequence GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers
• Gene ID (Entrez): 5354
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.