missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18368867

MYCL1/L-Myc Antibody, Novus Biologicals™

Product Code. 18368867 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18368867 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18368867 Supplier Novus Biologicals Supplier No. H00004610B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

MYCL1/L-Myc Polyclonal antibody specifically detects MYCL1/L-Myc in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MYCL1/L-Myc
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_005367.1
Gene Alias BHLHE38, bHLHe38myc-related gene from lung cancer, Class E basic helix-loop-helix protein 38, LMYCl-myc-1 proto-oncogene, MYCL, protein L-Myc-1, v-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived, v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian)
Host Species Mouse
Immunogen MYCL1 (NP_005367.1, 1 a.a. - 206 a.a.) full-length human protein. MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG
Purification Method Protein G purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Breast Cancer
Primary or Secondary Primary
Gene ID (Entrez) 4610
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.