missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MVK Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33225-20ul
This item is not returnable.
View return policy
Description
MVK Monoclonal antibody specifically detects MVK in Human samples. It is validated for ELISA,Western Blot
Specifications
| MVK | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| EC 2.7.1.36, LH receptor mRNA-binding protein, LRBP, mevalonate kinase, mevalonate kinase (mevalonic aciduria), mevalonate kinase 1, MKFLJ96772, MVLK | |
| A synthetic peptide corresponding to a sequence within amino acids 297-396 of human MVK (Q03426).,, Sequence:, LIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL | |
| 20 μL | |
| metabolism | |
| 4598 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction