missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Muscleblind-like 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | Muscleblind-like 1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Host Species | Rabbit |
Description
Muscleblind-like 1 Polyclonal specifically detects Muscleblind-like 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Muscleblind-like 1 | |
| Unconjugated | |
| Rabbit | |
| Chromatin Research, DNA replication Transcription Translation and Splicing | |
| DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein | |
| MBNL1 | |
| IgG | |
| Protein A purified |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_997179 | |
| 4154 | |
| Synthetic peptide directed towards the C terminal of human MBNL1. Peptide sequence LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title