MURF3 Antibody (2G9), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00057159-M02

Product Code. 18415079

Description

MURF3 Monoclonal antibody specifically detects MURF3 in Human samples. It is validated for Western Blot, ELISA

Specifications

• Antigen: MURF3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: MuRF, MuRF3, MURF-3, MURFtripartite motif-containing protein 54, Muscle-specific RING finger protein, Muscle-specific RING finger protein 3, RING finger protein 30muscle-specific RING-finger protein 3, RNF30, tripartite motif containing 54, tripartite motif-containing 54
• Immunogen: TRIM54 (NP_115935, 186 a.a. ∽ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERK
• Quantity: 0.1 mg
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 57159
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2b κ

• Applications: Western Blot, ELISA
• Clone: 2G9
• Dilution: Western Blot 1:500, ELISA
• Gene Accession No.: NP_115935
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified