missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Mucolipin 1 Antibody, Novus Biologicals™

Mucolipin 1 Antibody, Novus Biologicals™

Product Code. 18407071 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18407071 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. Se returpolicy
Produktkod. 18407071 Leverantör Novus Biologicals Leverantörsnummer NBP19215225ul

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody has been used in 2 publications

Mucolipin 1 Polyclonal specifically detects Mucolipin 1 in Human samples. It is validated for Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen Mucolipin 1
Applications Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Flow Cytometry -Reported in scientific literature (PMID:31950548)., Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Knockdown Validated - Reported in scientific literature ( (PMID: 31950548)
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias MG-2, ML4TRP-ML1, MLIV, MST080, MSTP080, mucolipidin, mucolipidosis type IV protein, mucolipin 1, mucolipin-1, TRPML1, TRP-ML1, TRPM-L1
Gene Symbols MCOLN1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Biology, Neuroscience, Sensory Systems, Signal Transduction, Vision
Primary or Secondary Primary
Gene ID (Entrez) 57192
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.