missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MUC12 Antibody (8B10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00010071-M01-100ug
This item is not returnable.
View return policy
Description
MUC12 Monoclonal antibody specifically detects MUC12 in Human samples. It is validated for Western Blot, ELISA
Specifications
| MUC12 | |
| Monoclonal | |
| Unconjugated | |
| XP_499350.1 | |
| Mouse | |
| Protein A or G purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 8B10 | |
| In 1x PBS, pH 7.4 | |
| MUC11, MUC-11, MUC-12, mucin 11, mucin 12, cell surface associated, mucin-11, mucin-12 | |
| MUC12 (XP_499350.1, 31 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGNTTSASTPSSSDPFTTFSDYGVSVTFITGSTATKHFLDSSTNSGHSEESTVSHSGPGATGTTLFPSHSATSVFVGEPKTSPITSASME | |
| 100 μg | |
| Cancer, Tumor Suppressors | |
| 10071 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction