missing translation for 'onlineSavingsMsg'
Learn More

MUC1 Antibody, Novus Biologicals™

Product Code. 18447990 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18447990 25 μL 25µL
18413611 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18447990 Supplier Novus Biologicals Supplier No. NBP18577825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MUC1 Polyclonal antibody specifically detects MUC1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen MUC1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4582
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.