missing translation for 'onlineSavingsMsg'
Få mere at vide

MTMR7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18383806 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
100 μg
Pakningsstørrelse:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18383806 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18383806 Leverandør Novus Biologicals Leverandørnr. NBP309576100UL

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Rabbit Polyclonal Antibody

MTMR7 Polyclonal specifically detects MTMR7 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen MTMR7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias MGC163449, MGC163451, myotubularin related protein 7, myotubularin-related protein 7
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTMR7. Peptide sequence EELEALEERLEKIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDY
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9108
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.