MTMR15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10992-100UL

Product Code. 18329912

Description

MTMR15 Polyclonal specifically detects MTMR15 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MTMR15
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: DKFZp451H236, EC 3.1.21.-, EC 3.1.4.1, FANCD2/FANCI-associated nuclease 1DKFZp686K16147, fanconi anemia associated nuclease 1, fanconi-associated nuclease 1, KIAA1018coiled-coil domain-containing protein MTMR15, MTMR15, myotubularin related protein 15, Myotubularin-related protein 15
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MTMR15 (NP_001139568.1). Peptide sequence QVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKREVKQKI
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22909
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.