missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTMR1 Antibody (1F10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00008776-M01
This item is not returnable.
View return policy
Description
MTMR1 Monoclonal antibody specifically detects MTMR1 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
| MTMR1 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| EC 3.1.3, EC 3.1.3.-, EC 3.1.3.48, myotubularin related protein 1, myotubularin-related protein 1 | |
| MTMR1 (NP_003819.1, 39 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 1F10 | |
| Western Blot, ELISA, Sandwich ELISA | |
| NP_003819 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 8776 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction