missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MTCH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | MTCH2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MTCH2 Polyclonal specifically detects MTCH2 in Human samples. It is validated for Western Blot.Specifications
| MTCH2 | |
| Polyclonal | |
| Rabbit | |
| Q9Y6C9 | |
| 23788 | |
| Synthetic peptides corresponding to MTCH2(mitochondrial carrier homolog 2 (C. elegans)) The peptide sequence was selected from the N terminal of MTCH2. Peptide sequence ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 2310034D24Rik, Met-induced mitochondrial protein, MIMP, mitochondrial carrier 2, mitochondrial carrier homolog 2, mitochondrial carrier homolog 2 (C. elegans) | |
| MTCH2 | |
| IgG | |
| 33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title