missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MT-ND5 Polyclonal antibody specifically detects MT-ND5 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | MT-ND5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | EC 1.6.5.3, mitochondrially encoded NADH dehydrogenase 5, MTND5, NAD5, NADH dehydrogenase subunit 5, NADH dehydrogenase, subunit 5 (complex I), NADH5, ND5NADH dehydrogenase 5 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of mouse MT-ND5 (NP_904338.1). KIIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLFMCSGSIIHSLADEQDIRKMGNITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAIN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?