missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MT-ND1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35818-100ul
This item is not returnable.
View return policy
Description
MT-ND1 Polyclonal antibody specifically detects MT-ND1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| MT-ND1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| EC 1.6.5.3, mitochondrially encoded NADH dehydrogenase 1, MTND1, NAD1, NADH dehydrogenase subunit 1, NADH dehydrogenase, subunit 1 (complex I), NADH1, ND1NADH dehydrogenase 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 151-251 of human MT-ND1 (YP_003024026.1).,, Sequence:, LLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDAL | |
| 100 μL | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 4535 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction