missing translation for 'onlineSavingsMsg'
Learn More

MT-CO2 Antibody - BSA Free, Novus Biologicals™

Product Code. 18679441 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18679441 0.1 mL 0.1mL
18666842 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18679441 Supplier Novus Biologicals Supplier No. NBP2944410.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MT-CO2 Polyclonal antibody specifically detects MT-CO2 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen MT-CO2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000, Immunohistochemistry 1:100 - 1:500, Immunohistochemistry-Paraffin
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias COII, COX2, COXII, Cytochrome C Oxidase II, Cytochrome C Oxidase Polypeptide II, Cytochrome C Oxidase Subunit II, EC 1.9.3.1, Mitochondrially Encoded Cytochrome C Oxidase II, MTCO2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 101-200 of mouse MT-CO2 (NP_904331.1). GHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4513
Target Species Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.