missing translation for 'onlineSavingsMsg'
Learn More

MSX1 Antibody (1E2), Novus Biologicals™

Product Code. 18325667 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18325667 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18325667 Supplier Novus Biologicals Supplier No. H00004487M11

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

MSX1 Monoclonal antibody specifically detects MSX1 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen MSX1
Applications Western Blot, ELISA, Immunocytochemistry, Immunoprecipitation
Classification Monoclonal
Clone 1E2
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002439
Gene Alias Homeobox protein Hox-7, homeobox protein MSX-1, HOX7homeobox 7, HYD1msh homeobox homolog 1 (Drosophila), msh (Drosophila) homeo box homolog 1 (formerly homeo box 7), msh homeo box 1, msh homeobox 1, Msh homeobox 1-like protein, msh homeobox homolog 1, OFC5, STHAG1
Host Species Mouse
Immunogen MSX1 (NP_002439, 216 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4487
Target Species Human, Mouse
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.