missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18369569

MST4 Antibody (7H4), Novus Biologicals™

Product Code. 18369569 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18369569 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18369569 Supplier Novus Biologicals Supplier No. H00051765M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

MST4 Monoclonal antibody specifically detects MST4 in Human, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen MST4
Applications Western Blot, ELISA, Immunocytochemistry, Sandwich ELISA
Classification Monoclonal
Clone 7H4
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057626
Gene Alias EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 4, mammalian sterile 20-like 4, MASK, Mst3 and SOK1-related kinase, MST-4, serine/threonine protein kinase MASK, serine/threonine protein kinase MST4, Serine/threonine-protein kinase MASK, serine/threonine-protein kinase MST4, STE20-like kinase MST4
Host Species Mouse
Immunogen RP6-213H19.1 (NP_057626, 331 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADES
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 51765
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.