missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MST3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
£213.00 - £459.00
Specifications
| Antigen | MST3 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, ELISA, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18403722
|
Novus Biologicals
NBP1-87833-25ul |
25 μL |
£213.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18705673
|
Novus Biologicals
NBP1-87833 |
0.1 mL |
£459.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MST3 Polyclonal specifically detects MST3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MST3 | |
| Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 3, MST-3, MST3serine/threonine kinase 24 (Ste20, yeast homolog), serine/threonine kinase 24, serine/threonine-protein kinase 24, STE20, STE20-like kinase 3, STE20-like kinase MST3, sterile 20-like kinase 3, STK3yeast) | |
| STK24 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, ELISA, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8428 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title