MST3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35153-100ul

Product Code. 30231978

Description

MST3 Polyclonal antibody specifically detects MST3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: MST3
• Classification: Polyclonal
• Dilution: Western Blot 1:1000 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 3, MST-3, MST3serine/threonine kinase 24 (Ste20, yeast homolog), serine/threonine kinase 24, serine/threonine-protein kinase 24, STE20, STE20-like kinase 3, STE20-like kinase MST3, sterile 20-like kinase 3, STK3yeast)
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 312-431 of human MST3 (NP_001027467.2).,, Sequence:, TDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 8428
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified