MS4A4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18483901	Novus Biologicals NBP1-86542-25ul	25 μL
18234597	Novus Biologicals NBP1-86542	0.1 mL

Description

MS4A4A Polyclonal specifically detects MS4A4A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MS4A4A
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51338
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: 4SPAN1, CD20 antigen-like 1, CD20L1CD20-L1, Fc epsilon receptor beta subunit homolog, Four-span transmembrane protein 1, membrane-spanning 4-domains subfamily A member 4A, membrane-spanning 4-domains, subfamily A, member 4, membrane-spanning 4-domains, subfamily A, member 4A, MS4A4MGC22311, MS4A7
• Gene Symbols: MS4A4A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only