missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MS4A12 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94041-0.1ml
This item is not returnable.
View return policy
Description
MS4A12 Polyclonal antibody specifically detects MS4A12 in Human samples. It is validated for Western Blot
Specifications
| MS4A12 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| FLJ20217, membrane-spanning 4-domains subfamily A member 12, membrane-spanning 4-domains, subfamily A, member 12, Ms4a10 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MS4A12 (NP_060186.2). MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINPSVGTAVMNFKEEAKA | |
| 0.1 mL | |
| Cell Biology | |
| 54860 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction