MRPS34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-82729-25ul

Product Code. 18460481

Description

MRPS34 Polyclonal specifically detects MRPS34 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: MRPS34
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
• Gene Alias: MGC2616, mitochondrial ribosomal protein S34, MRPS12, MRP-S12,28S ribosomal protein S34, mitochondrial, MRP-S34, S34mt
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human MRPS34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MRPS34
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 65993
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only