missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPS31 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33240-100ul
This item is not returnable.
View return policy
Description
MRPS31 Monoclonal antibody specifically detects MRPS31 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| MRPS31 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| 28S ribosomal protein S31, mitochondrial, IMOGN38Imogen 38, mitochondrial ribosomal protein S31, MRP-S31, S31mt | |
| A synthetic peptide corresponding to a sequence within amino acids 296-395 of human MRPS31 (Q92665).,, Sequence:, NGFEELIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKKDILKESNIQFN | |
| 100 μL | |
| Endocrinology, Immunology | |
| 10240 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction