MRPS16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-33721-25ul

Product Code. 18434752

Description

MRPS16 Polyclonal specifically detects MRPS16 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRPS16
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9Y3D3
• Gene Symbols: MRPS16
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGE
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 51021
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CGI-132, COXPD2, FLJ22062, FLJ40972, mitochondrial ribosomal protein S16, MRP-S16,28S ribosomal protein S16, mitochondrial, RPMS16, S16mt
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only