missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL49 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13618
This item is not returnable.
View return policy
Description
MRPL49 Polyclonal specifically detects MRPL49 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MRPL49 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C11orf4, L49mt39S ribosomal protein L49, mitochondrial, mitochondrial ribosomal protein L49, MRP-L49, Neighbor of FAU, next to FAU, NOF1chromosome 11 open reading frame 4, NOFMGC10656, Protein NOF1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MRPL49 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF | |
| 0.1 mL | |
| Stem Cell Markers | |
| 740 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction