missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRPL37 Antibody, Novus Biologicals™

MRPL37 Antibody, Novus Biologicals™

Product Code. 18409240 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18409240 25ul 25µL
18278065 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18409240 Supplier Novus Biologicals Supplier No. NBP18103225ul

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody has been used in 1 publication

MRPL37 Polyclonal specifically detects MRPL37 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen MRPL37
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9BZE1
Gene Alias 39S ribosomal protein L2, mitochondrial, L2mt, L37mt, MGC878, mitochondrial ribosomal protein L37, MRP-L2MRPL2, MRP-L37, ribosomal protein, mitochondrial, L2, RPML239S ribosomal protein L37, mitochondrial
Gene Symbols MRPL37
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 51253
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.