MRPL37 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP1-81032-25ul

Product Code. 18409240

Description

MRPL37 Polyclonal specifically detects MRPL37 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRPL37
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Accession No.: Q9BZE1
• Gene Symbols: MRPL37
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
• Quantity: 25ul
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51253
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 39S ribosomal protein L2, mitochondrial, L2mt, L37mt, MGC878, mitochondrial ribosomal protein L37, MRP-L2MRPL2, MRP-L37, ribosomal protein, mitochondrial, L2, RPML239S ribosomal protein L37, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only