MRPL28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38760

Product Code. 18169957

Description

MRPL28 Polyclonal specifically detects MRPL28 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRPL28
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q13084
• Gene Symbols: MRPL28
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANND
• Quantity: 0.1 mL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 10573
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: L28mt, MAAT139S ribosomal protein L28, mitochondrial, Melanoma antigen p15, melanoma-associated antigen recognised by cytotoxic T lymphocytes, Melanoma-associated antigen recognized by T lymphocytes, MGC8499, mitochondrial ribosomal protein L28, MRP-L28, p15
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.