missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59806
This item is not returnable.
View return policy
Description
MRP3 Polyclonal specifically detects MRP3 in Human samples. It is validated for Western Blot.
Specifications
| MRP3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ABC31, ATP-binding cassette sub-family C member 3, ATP-binding cassette, sub-family C (CFTR/MRP), member 3, canalicular multispecific organic anion transporter 2, canicular multispecific organic anion transporter, cMOAT2, EC 3.6.3, EC 3.6.3.44, EC 6.3.2.4, MLP2DKFZp686E22157, MRP3MOAT-DEST90757, multidrug resistance associated protein, Multidrug resistance-associated protein 3, Multi-specific organic anion transporter D | |
| Rabbit | |
| 168 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 78%; Canine: 76%. | |
| Human, Rat, Pig, Canine, Equine, Guinea Pig | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O15438 | |
| ABCC3 | |
| Synthetic peptides corresponding to ABCC3(ATP-binding cassette, sub-family C (CFTR/MRP), member 3) The peptide sequence was selected from the middle region of ABCC3. Peptide sequence KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL. | |
| Affinity purified | |
| RUO | |
| 8714 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction