missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £442.00
Specifications
| Antigen | MRP2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230881
|
Novus Biologicals
NBP3-38537-20ul |
20 μL |
£164.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232940
|
Novus Biologicals
NBP3-38537-100ul |
100 μL |
£442.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MRP2 Polyclonal antibody specifically detects MRP2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| MRP2 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Diabetes Research, Lipid and Metabolism | |
| PBS (pH 7.3), 50% glycerol | |
| 1244 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ATP-binding cassette, sub-family C (CFTR/MRP), member 2, Canalicular multidrug resistance protein, canalicular multispecific organic anion transporter 1, CMOAT1, CMOATABC30, CMRP, DJS, KIAA1010, MRP2ATP-binding cassette sub-family C member 2, Multidrug resistance-associated protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 180-315 of human MRP2 (NP_000383.1).,, Sequence:, ETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title